95% Anti-Aging Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Senolytics Poeder CAS No. 616204-22-9
Beschrijving
Anti-aging FOXO4 D-Retro-Inverso peptide 95% FOXO4-DRI 98% Senolytiepoeder
EGF, FGF, KGF, SOD, FOXO4-dri en alle cosmetische poeder
Er zijn zowel ruw poeder als ingevroren fijn poeder beschikbaar.
Fysieke
tekens
en
specificaties
Levert FOXO4-DRI rauw poeder en vriespoeder in vials.
| Naam | FOXO4 DRI |
| CAS | N.V.T. |
| Kwaliteitsstandaard | Injectiekwaliteit |
| COA | PLS-contact met Senwayer vrij |
| MOQ | 10 mg |
| Uiterlijk | Wit poeder |
| Zuiverheid, % (door RP-HPLC) | 95% |
| Eenheid activiteit | N.V.T. |
| PH-waarde | N.V.T. |
| ISO-elektrisch punt | N.V.T. |
| Waterresten | N.V.T. |
| Identificatietest | N.V.T. |
| Opslag | 2 - 8 graden |
| UITLOOPTIJD | 2 jaar |
Productbeschrijving
FOXO4 D-Retro-Inverso peptide, ook bekend als FOXO4 DRI peptide, werd voor het eerst gemeld in 'Targeted Apoptosis of Senescent CELLS Restores Tissue homeostasis in Response to Chemotoxicity and Aging' door Baar et al.
FOXO4 DRI peptide bestaande uit de aminozuur sequentie: LTLRKEPASEIAQSILEAYSQNGWANRRSGKRP, waarin de aminozuren in genoemde aminozuur sequentie zijn D-aminozuur residu's. FOXO4 D-Retro-Inverso peptide induceert selectief apoptose van senescente cellen keert de effecten van chemotoxiciteit en veroudering bij muizen om
| Nee | Productnaam | CAS-nr. |
| Anti-rimpel en Anti-Aging Series | ||
| 1 | Acetyl hexapeptide-8 | 616204-22-9 |
| 2 | Acetyl Octapeptide-3/Snap-8 | 868844-74-0 |
| 3 | Palmitoyl tripeptide-5 /collageen Peptide | 623172-56-5 |
| 4 | Palmitoyl pentapeptide-4 /Matrixyl acetaat | 214047-00-4 |
| 5 | Pentapeptide-18 /Leuphasyl | 64963-01-5 |
| 6 | Hexapeptide-10/Serilesine | 146439-94-3 |
| 7 | Palmitoyl hexapeptide / Lipopeptide Acetaat | 171263-26-6 |
| 8 | Palmitoyl tripeptide-1 | 147732-56-7 |
| 9 | Pentapeptide-3/Vialox Peptide | 135679-88-8 |
| 10 | Acetyl Tetraptide-2 | 757942-88-4 |
| 11 | Acetyl Tetraptide-9 | 928006-50-2 |
| 12 | L-Carnosine | 305-84-0 |
| 13 | Decorinyl/Tripeptide-10 Citrulline | 960531-53-7 |
| 14 | Palmitoyl tripeptide-38 | 1447824-23-8 |
| 15 | Acetyl Decapeptide-3 | 935288-50-9 |
| 16 | Hexapeptide-11 | --------- |
| Witten en verwijderen van series | ||
| 1 | Nonapeptide-1/Melitane | 158563-45-2 |
| 2 | Tetrapeptide-30 | ------------------- |
| 3 | Decapeptide-12 | ------------------- |
| 4 | Hexapeptide-2 | ------------------- |
| 5 | Melanostatine DM | 123689-72-5 |
| 6 | Oligopeptide-68 | 1206525-47-4 |
| Serie voor oogverzorging en haargroei | ||
| 1 | Acetyl Tetraptide-5/Eyeseryl | 820959-17-9 |
| 2 | Myristoyl Pentapeptide-17 | 959610-30-1 |
| 3 | Myristoyl Tetraptide-12 | 959610-24-3 |
| 4 | Acetyl Tetraptide-3/Capixyl | 155149-79-4 |
| 5 | Biotinoyltripeptide-1 | 299157-54-3 |
| 6 | Melitane/Acetyl Hexapeptide-1 | 448944-47-6 |
| 7 | Myristoyl Pentapeptide-4 | ------------------- |
| Anti-allergisch en huidreparatie | ||
| 1 | PAL-Tetrapeptide-7/PAL-Tetrapeptide-3 | 221227-05-0 |
| 2 | Koperpeptide | 49557-75-7 |
| 3 | Hexapeptide-9 | 1228371-11-6 |
| 4 | Palmitoyl tripeptide-8 | 936544-53-5 |
| 5 | Oligopeptide-10 | ------------------- |
| 6 | LZ1 Peptide | ------------------- |
| Borstserie | ||
| 1 | Acetyl hexapeptide-38 | 1400634-44-7 |
| Gewichtsverlies serie | ||
| 1 | Acetyl hexapeptide-39 | ------------------- |
Farmaceutische Tussenproducten
-
Second hand Pacific PSF-productielijn
Eén kant ongetrimde Emulsion 300GSM Fiberglass gehakte Strand Mat
Volledig automatische inder-blokvormingsinstallatie Hourdi-bakmachine
Vet oplossen Lipo Lab Lipolyse injectie fosfatidyllcholine Ppc oplossing voor Buik armen benen
Rhegf Recombinant menselijke groei van de epidermale groei
NKI Radiaal Needle Roller lager Nki17/16 Nki17/20 Nki20/16 Nki20/20 Nki22/16 Nki22/20 naaldlager met binnenring
150 PK watergekoelde 6 cilinders Elektrische starter/directe inspuiting/ 4 Slagen Ricardo dieselpomp reserveonderdelen dieselmotor voor generator
Gratis monster Ms ST45 S235JR Q195 Q215 A36 Q235B koolstof Stalen spoel
Rotor Spinning machine van Qingdao Hongda
NB F160 gasveer 10-27-inch montage met dubbele monitorhouder
RPNA Serie Uitlijnen Needle Roller Bearings(RPNA15/28 RPNA18/32 RPNA20/35 RPNA25/42 RPNA28/44 RPNA30/47 RPNA35/52 RPNA40/55 RPNA45/62)
Remschijf voor Auto-Part voor Land Cruiser Hzj79 (43512- 60141 )
Restaurant Roll Top 9L volledig Gold roestvrij staal buffet chafing Schotel
Linalool -oxide; linalool -oxide; Epoxydihydrolinalool; CAS: 1365-19-1
Speciale kleur linker/rechter 24/410 pomp voor fles
5kw 48V hoogfrequente MPPT-oplader voor zonnecomverters allemaal In een uit Grid Solar Hybrid Inverter